SiftStock
Close-up of a matte black chalkboard surface filling the frame with subtle texture and smudges

Close-up of a matte black chalkboard surface filling the frame with subtle texture and smudges

Dimensions
5376 × 3584
File
JPEG

Use without downloading

NEWUnlimited

Both options already include attribution — nothing to add.

Tags

chalkboardblackeducationclassroombackgroundschoolwritingdrawingteachinglearninglessonboardemptyblankundrawnundecoratederasedusedretroschoolroomacademicstudyinstructioncopyspacemattesurfacetexturecloseupflatlaydarkminimalsimplecleansmoothgrainsubtlesmudgedvintagemonochrome

More from this series

Close-up flat lay of a matte black chalkboard surface filling the frame with subtle texture and even lighting
Close-up flat lay of a matte black chalkboard surface filling the frame
Close-up of a matte black chalkboard surface filling the frame with subtle texture and smudges

More like this

Worn black chalkboard surface with smudges and scratches in flat lay closeup
Close-up of a dark chalkboard surface with smudged texture and faint marks
Weathered black chalkboard surface with faint chalk marks and scratches, flat lay view
Close-up of a dark smudged chalkboard surface with erased writing and chalk residue