SiftStock
Close-up flat lay of a matte black chalkboard surface filling the frame with subtle texture and even lighting

Close-up flat lay of a matte black chalkboard surface filling the frame with subtle texture and even lighting

Dimensions
5376 × 3584
File
JPEG

Use without downloading

NEWUnlimited

Both options already include attribution — nothing to add.

Tags

chalkboardblackeducationclassroombackgroundschoolwritingdrawingteachinglearninglessonboardslateemptyblankundrawnundecoratedpigmentbasednonreflectiveeducationalacademicstudyinstructioncopyspacedesignsurfacetexturemattecloseupflatlaydarkminimalsimplecleansmoothgrainsubtlebrushedmonochrome

More from this series

Close-up flat lay of a matte black chalkboard surface filling the frame
Close-up of a matte black chalkboard surface filling the frame with subtle texture and smudges

More like this

Close-up of a dark chalkboard surface with smudged white chalk residue, showing erased writing and texture
Weathered black chalkboard surface with faint chalk marks and scratches, flat lay view
Dark chalkboard surface with smudged chalk marks and even texture, showing horizontal strokes and subtle gradient across the frame
Worn black chalkboard surface with smudges and scratches in flat lay closeup