SiftStock
High-protein foods arranged on whitewashed wooden surface with copyspace

High-protein foods arranged on whitewashed wooden surface with copyspace

Dimensions
5376 × 3584
File
JPEG

Use without downloading

NEWUnlimited

Both options already include attribution — nothing to add.

Tags

proteinfooddietnutritionsalmonbeefchickenshrimpeggswhitewashedcheesemilkyogurtcottagenutsbeansdairyanimalmeatseafoodpoultryeggcalciumhealthylowcarbketogenicketoweightlossfitnessbodybuildingsupplementmealprepgrocerypantrykitchencopyspacehighwoodenflatlaytopview

More from this series

High-protein foods arranged on a whitewashed wooden table with copyspace on the left
High-protein foods arranged on a whitewashed wooden table in flat lay view
High-protein foods arranged on a whitewashed wooden table with copyspace on the left

More like this

High-protein foods arranged on a white-painted wooden surface in a flat lay composition
High-protein foods arranged on a wooden cutting board with meat, fish, eggs, dairy, nuts and legumes
Assorted high-protein foods including meat, eggs, fish, vegetables and nuts arranged on a rustic wooden cutting board
High-protein foods arranged in a flat lay on a white surface