SiftStock
Halved tortilla wraps with visible vegetables and chicken in plastic containers on a refrigerated shelf

Halved tortilla wraps with visible vegetables and chicken in plastic containers on a refrigerated shelf

Dimensions
5888 × 3296
File
JPEG

Use without downloading

NEWUnlimited

Both options already include attribution — nothing to add.

Tags

wrapsandwichdelifoodlunchmealtortillavegetablechickensaladrefrigeratedlettucetomatocheesepackagingdisplaygrocerystoresupermarketretailconveniencereadytoeathealthyfreshnutritionproteinfiberprepcateringofficebreaksnacktakeawayserviceplasticcontainershelfphotographycloseup

More from this series

Halved tortilla wraps with vegetables and chicken in clear plastic containers on a refrigerated deli shelf
Halved tortilla wraps with vegetables and chicken in plastic containers on refrigerated display shelf
Halved tortilla wraps with vegetables and protein in clear plastic containers displayed in a refrigerated case

More like this

Refrigerated display case filled with ready-to-eat sandwiches, salads, and beverages in a convenience store
Stacked clear plastic containers filled with salads and meals on a refrigerated shelf
Two grilled tortilla wraps stacked on a small wooden pallet with visible fillings of avocado, asparagus, tomato, egg and chicken on a white textured surface
Food service worker arranging salad containers on a stainless steel tray