SiftStock
Overhead flat lay of diverse whole foods including salmon, beef, avocado, broccoli, sweet potato, tomatoes, beans, almonds, and olive oil arranged on a white surface

Overhead flat lay of diverse whole foods including salmon, beef, avocado, broccoli, sweet potato, tomatoes, beans, almonds, and olive oil arranged on a white surface

Dimensions
6752 × 2880
File
JPEG

Use without downloading

NEWUnlimited

Both options already include attribution — nothing to add.

Tags

foodnutritionhealthydietwholefoodsproteinbeefavocadobroccolisweetpotatotomatoesbeansalmondsoliveoilorganicarrangementpeaslentilsvegetablesfruitsgrainslegumesnutsseedsnaturalwellnessfitnessmealprepkitchenvarietybalancedvitaminmineralantioxidantleanplantbasedtableflatlayoverheadsalmon

More from this series

Overhead flat lay of whole foods including salmon, beef, broccoli, avocado, sweet potato, tomato, kale, peas, hazelnuts, beans, pumpkin, and olive oil arranged on a white surface
Overhead flat lay of diverse whole foods arranged on a white surface including salmon, beef, avocado, broccoli, sweet potatoes, kale, tomatoes, peas, nuts, beans, and olive oil
Overhead flat lay of diverse whole foods including salmon, beef, broccoli, sweet potato, tomato, avocado, kale, papaya, beans, nuts, and olive oil arranged on white surface

More like this

Variety of nutritious foods including salmon, vegetables, dairy, grains, and nuts arranged on a grey surface
Assorted whole foods arranged in a row along the bottom edge of a white surface
High-protein foods arranged in bowls and on a white surface in a flat lay composition
Fresh healthy foods arranged in a flat lay on a white textured surface