SiftStock
Overhead flat lay of fresh whole foods including salmon, eggs, vegetables, fruits, grains, and dairy arranged on dark surface

Overhead flat lay of fresh whole foods including salmon, eggs, vegetables, fruits, grains, and dairy arranged on dark surface

Dimensions
6752 × 2880
File
JPEG

Use without downloading

NEWUnlimited

Both options already include attribution — nothing to add.

Tags

foodhealthynutritiondietfreshwholeeggscheesebroccolivegetablesfruitsdairygrainsorganictomatoescarrotsgrapesappleasparagusmushroomsonionslemonpastabeanslentilsproteinfibervitaminantioxidantnaturalwellnessfitnessmealprepgrocerysupermarketkitchenstilllifeflatlayoverheadsalmon

More from this series

Overhead flat lay of fresh whole foods including vegetables, fruits, protein, and grains arranged on dark surface
Overhead flat lay of fresh whole foods arranged on dark surface including vegetables, fruits, salmon, eggs, cheese, pasta, mushrooms, and legumes
Overhead flat lay of fresh whole foods including vegetables, fruits, protein, and grains arranged on dark surface

More like this

Variety of whole foods arranged on a weathered wooden surface in a flat lay composition
Overhead flat lay of assorted whole foods densely arranged on dark surface
Overhead flat lay of fresh vegetables fruits eggs dairy grains and legumes arranged on wooden table
Top-down arrangement of fresh groceries including salmon, meat, eggs, vegetables and fruits on dark surface