SiftStock
Grilled salmon on rice with broccoli and lemon in a compartmentalized glass lunchbox beside an apple and office supplies on a white surface

Grilled salmon on rice with broccoli and lemon in a compartmentalized glass lunchbox beside an apple and office supplies on a white surface

Dimensions
5376 × 3584
File
JPEG

Use without downloading

NEWUnlimited

Both options already include attribution — nothing to add.

Tags

mealpreplunchboxgrilledricebroccolilemontomatoapplecompartmentalizedofficeorganiclettuceeggalmondshealthydietnutritionbalancedfoodworkdeskpenstilllifeplanningweightlossfitnesswellnessfreshvitaminproteincarbohydratecontainerglasspapersurfaceflatlaytopviewoverheadsalmonwhite

More from this series

Grilled salmon on rice with broccoli and salad in a black meal prep container on a white surface
Grilled salmon with rice and vegetables in a divided lunchbox on a desk surface
Grilled salmon on rice with broccoli, tomatoes, almonds and egg in a compartmentalized lunchbox on a desk

More like this

A meal prep container with salad, almonds, hardboiled egg and apple on a dark wooden table
Four glass meal prep containers arranged in a row on a white surface, each filled with balanced meals of protein, vegetables, and grains
Four glass meal prep containers with balanced meals arranged in a row on a white surface
Grilled chicken and rice salad in glass meal prep container with soy sauce on gray surface